SCOP 1.71: Domain d1xb8c_: 1xb8 C:

Lineage for d1xb8c_ (1xb8 C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (36 PDB entries)

8. Domain d1xb8c_: 1xb8 C: [115065]
   complexed with zn; mutant

Details for d1xb8c_

PDB Entry: 1xb8, 2 Å

PDB Description: zn substituted form of d62c/k74c double mutant of pseudomonas aeruginosa azurin

SCOP Domain Sequences for d1xb8c_:

Sequence; same for both SEQRES and ATOM records:

>d1xb8c_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtc
gmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalmk
gtltlk

Timeline for d1xb8c_:

• d1xb8c_ is new in SCOP 1.71
  
• d1xb8c_ appears in SCOP 1.73
  
• d1xb8c_ appears in the current release, SCOPe 2.08