Lineage for d1xb3b_ (1xb3 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774206Protein Azurin [49530] (6 species)
  7. 1774237Species Pseudomonas aeruginosa [TaxId:287] [49533] (87 PDB entries)
    Uniprot P00282
  8. 1774264Domain d1xb3b_: 1xb3 B: [115061]
    complexed with cu; mutant

Details for d1xb3b_

PDB Entry: 1xb3 (more details), 1.5 Å

PDB Description: the d62c/k74c double mutant of pseudomonas aeruginosa azurin
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d1xb3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb3b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkggeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d1xb3b_:

Click to download the PDB-style file with coordinates for d1xb3b_.
(The format of our PDB-style files is described here.)

Timeline for d1xb3b_: