| Class b: All beta proteins [48724] (165 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins) mono-domain proteins |
| Protein Azurin [49530] (6 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [49533] (36 PDB entries) |
| Domain d1xb3a_: 1xb3 A: [115060] |
PDB Entry: 1xb3 (more details), 1.5 Å
SCOP Domain Sequences for d1xb3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb3a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkggeqymffctfpghsal
mkgtltlk
Timeline for d1xb3a_: