SCOP 1.71: Domain d1xb3a_: 1xb3 A:

Lineage for d1xb3a_ (1xb3 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (36 PDB entries)

8. Domain d1xb3a_: 1xb3 A: [115060]

Details for d1xb3a_

PDB Entry: 1xb3, 1.5 Å

PDB Description: the d62c/k74c double mutant of pseudomonas aeruginosa azurin

SCOP Domain Sequences for d1xb3a_:

Sequence; same for both SEQRES and ATOM records:

>d1xb3a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkggeqymffctfpghsal
mkgtltlk

Timeline for d1xb3a_:

• d1xb3a_ is new in SCOP 1.71
  
• d1xb3a_ appears in SCOP 1.73
  
• d1xb3a_ appears in the current release, SCOPe 2.08