SCOPe 2.05: Domain d1xb2b3: 1xb2 B:223-331

Lineage for d1xb2b3 (1xb2 B:223-331)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
   beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123

4. Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family)
   comprises two structural repeats of this fold

5. Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)

7. Species Cow (Bos taurus), mitochondrial [TaxId:9913] [117891] (1 PDB entry)
   Uniprot P43896 56-331

8. Domain d1xb2b3: 1xb2 B:223-331 [115059]
   Other proteins in same PDB: d1xb2a1, d1xb2a2, d1xb2a3, d1xb2b1

Details for d1xb2b3

PDB Entry: 1xb2, 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex

PDB Compounds: (B:) Elongation factor Ts, mitochondrial

SCOPe Domain Sequences for d1xb2b3:

Sequence; same for both SEQRES and ATOM records:

>d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
gfyvgsyvhgamhspslhnlvlgkygalvicetselkanladlgrrlgqhvvgmaplsvg
slddepggeaetkmlsqpylldpsitlgqyvqphgvsvvdfvrfecgeg

Timeline for d1xb2b3:

• d1xb2b3 first appeared in SCOP 1.71
  
• d1xb2b3 appears in SCOPe 2.04
  
• d1xb2b3 appears in SCOPe 2.06
  
• d1xb2b3 appears in the current release, SCOPe 2.08