Lineage for d1xb2b1 (1xb2 B:56-111)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763729Family a.5.2.2: TS-N domain [63423] (1 protein)
  6. 763730Protein Elongation factor Ts (EF-Ts), N-terminal domain [63424] (4 species)
  7. 763731Species Cow (Bos taurus), mitochondrial [TaxId:9913] [116836] (1 PDB entry)
    Uniprot P43896 56-331
  8. 763732Domain d1xb2b1: 1xb2 B:56-111 [115057]
    Other proteins in same PDB: d1xb2a1, d1xb2a2, d1xb2a3, d1xb2b2, d1xb2b3

Details for d1xb2b1

PDB Entry: 1xb2 (more details), 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex
PDB Compounds: (B:) Elongation factor Ts, mitochondrial

SCOP Domain Sequences for d1xb2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
sasskellmklrrktgysfinckkaletcggdlkqaeswlhkqaqkegwskaarlh

SCOP Domain Coordinates for d1xb2b1:

Click to download the PDB-style file with coordinates for d1xb2b1.
(The format of our PDB-style files is described here.)

Timeline for d1xb2b1: