Lineage for d1xb2a3 (1xb2 A:56-250)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867148Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2867149Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (2 PDB entries)
    Uniprot P49410 56-452
  8. 2867150Domain d1xb2a3: 1xb2 A:56-250 [115056]
    Other proteins in same PDB: d1xb2a1, d1xb2a2, d1xb2b1, d1xb2b2, d1xb2b3

Details for d1xb2a3

PDB Entry: 1xb2 (more details), 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex
PDB Compounds: (A:) Elongation factor Tu, mitochondrial

SCOPe Domain Sequences for d1xb2a3:

Sequence, based on SEQRES records: (download)

>d1xb2a3 c.37.1.8 (A:56-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
phvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahvey
staarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigveh
vvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglks
vqklldavdtyipvp

Sequence, based on observed residues (ATOM records): (download)

>d1xb2a3 c.37.1.8 (A:56-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
phvnvgtighvdhgkttltaaitkilaehveystaarhyahtdcpghadyvknmitgtap
ldgcilvvaandgpmpqtrehlllarqigvehvvvyvnkadavqdsemvelveleirell
tefgykgeetpiivgsalcaleqrdpelglksvqklldavdtyipvp

SCOPe Domain Coordinates for d1xb2a3:

Click to download the PDB-style file with coordinates for d1xb2a3.
(The format of our PDB-style files is described here.)

Timeline for d1xb2a3: