![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
![]() | Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (2 PDB entries) Uniprot P49410 56-452 |
![]() | Domain d1xb2a2: 1xb2 A:349-452 [115055] Other proteins in same PDB: d1xb2a1, d1xb2a3, d1xb2b1, d1xb2b2, d1xb2b3 |
PDB Entry: 1xb2 (more details), 2.2 Å
SCOPe Domain Sequences for d1xb2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb2a2 b.44.1.1 (A:349-452) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikws
Timeline for d1xb2a2: