SCOP 1.71: Domain d1xb0f_: 1xb0 F:

Lineage for d1xb0f_ (1xb0 F:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)

6. Protein BIR-containing protein 8 [118349] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries)

8. Domain d1xb0f_: 1xb0 F: [115047]
   first BIR domain; complexed with a diablo homolog peptide, chains G, H, I, J, K, L
   complexed with zn

Details for d1xb0f_

PDB Entry: 1xb0, 2.2 Å

PDB Description: Structure of the BIR domain of IAP-like protein 2

SCOP Domain Sequences for d1xb0f_:

Sequence; same for both SEQRES and ATOM records:

>d1xb0f_ g.52.1.1 (F:) BIR-containing protein 8 {Human (Homo sapiens)}
tnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpk
edpweqhakwypgckylleekgheyinnihltrslegalvqtt

Timeline for d1xb0f_:

• d1xb0f_ is new in SCOP 1.71
  
• d1xb0f_ appears in SCOP 1.73
  
• d1xb0f_ appears in the current release, SCOPe 2.08