![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins) |
![]() | Protein BIR-containing protein 8 [118349] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries) |
![]() | Domain d1xb0d_: 1xb0 D: [115045] |
PDB Entry: 1xb0 (more details), 2.2 Å
SCOP Domain Sequences for d1xb0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb0d_ g.52.1.1 (D:) BIR-containing protein 8 {Human (Homo sapiens)} nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke dpweqhakwypgckylleekgheyinnihlt
Timeline for d1xb0d_: