Lineage for d1xb0c_ (1xb0 C:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751665Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 751666Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 751667Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)
  6. 751739Protein BIR-containing protein 8 [118349] (1 species)
  7. 751740Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries)
  8. 751743Domain d1xb0c_: 1xb0 C: [115044]

Details for d1xb0c_

PDB Entry: 1xb0 (more details), 2.2 Å

PDB Description: Structure of the BIR domain of IAP-like protein 2
PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 8

SCOP Domain Sequences for d1xb0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb0c_ g.52.1.1 (C:) BIR-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]}
nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
dpweqhakwypgckylleekgheyinnihlt

SCOP Domain Coordinates for d1xb0c_:

Click to download the PDB-style file with coordinates for d1xb0c_.
(The format of our PDB-style files is described here.)

Timeline for d1xb0c_: