Class g: Small proteins [56992] (79 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins) |
Protein BIR-containing protein 8 [118349] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries) |
Domain d1xb0b_: 1xb0 B: [115043] |
PDB Entry: 1xb0 (more details), 2.2 Å
SCOP Domain Sequences for d1xb0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb0b_ g.52.1.1 (B:) BIR-containing protein 8 {Human (Homo sapiens)} lprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpked pweqhakwypgckylleekgheyinnihltrslegalvqtt
Timeline for d1xb0b_: