Lineage for d1xb0a_ (1xb0 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642860Protein BIR-containing protein 8 [118349] (1 species)
  7. 2642861Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries)
    Uniprot Q96P09 1-84
  8. 2642862Domain d1xb0a_: 1xb0 A: [115042]
    first BIR domain; complexed with a diablo homolog peptide, chains G, H, I, J, K, L
    complexed with zn

Details for d1xb0a_

PDB Entry: 1xb0 (more details), 2.2 Å

PDB Description: Structure of the BIR domain of IAP-like protein 2
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 8

SCOPe Domain Sequences for d1xb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb0a_ g.52.1.1 (A:) BIR-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpk
edpweqhakwypgckylleekgheyinnihlt

SCOPe Domain Coordinates for d1xb0a_:

Click to download the PDB-style file with coordinates for d1xb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xb0a_: