| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein B and T lymphocyte attenuator, Btla [117041] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [117042] (1 PDB entry) Uniprot Q7TSA3 40-143 |
| Domain d1xaua_: 1xau A: [115041] complexed with cd |
PDB Entry: 1xau (more details), 1.8 Å
SCOPe Domain Sequences for d1xaua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]}
cevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvplevgpqlytswe
enrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvr
Timeline for d1xaua_: