Lineage for d1xaua_ (1xau A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753561Protein B and T lymphocyte attenuator, Btla [117041] (1 species)
  7. 2753562Species Mouse (Mus musculus) [TaxId:10090] [117042] (1 PDB entry)
    Uniprot Q7TSA3 40-143
  8. 2753563Domain d1xaua_: 1xau A: [115041]
    complexed with cd

Details for d1xaua_

PDB Entry: 1xau (more details), 1.8 Å

PDB Description: structure of the btla ectodomain
PDB Compounds: (A:) B- and T-lymphocyte attenuator

SCOPe Domain Sequences for d1xaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]}
cevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvplevgpqlytswe
enrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvr

SCOPe Domain Coordinates for d1xaua_:

Click to download the PDB-style file with coordinates for d1xaua_.
(The format of our PDB-style files is described here.)

Timeline for d1xaua_: