![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Domain d1xarb_: 1xar B: [115040] includes extra N-terminal oligomerisation helix (251-265) complexed with na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xar (more details), 2.25 Å
SCOPe Domain Sequences for d1xarb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xarb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} eltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeq nflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefs gsgwndnrcdvdnywickkpaacf
Timeline for d1xarb_: