SCOPe 2.08: Domain d1xara_: 1xar A:

Lineage for d1xara_ (1xar A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)
   Uniprot Q9NNX6 219-397

8. Domain d1xara_: 1xar A: [115039]
   includes extra N-terminal oligomerisation helix (251-265)
   complexed with na
   has additional insertions and/or extensions that are not grouped together

Details for d1xara_

PDB Entry: 1xar, 2.25 Å

PDB Description: Crystal Structure of a fragment of DC-SIGNR (containing the carbohydrate recognition domain and two repeats of the neck).

PDB Compounds: (A:) CD209 antigen-like protein 1

SCOPe Domain Sequences for d1xara_:

Sequence; same for both SEQRES and ATOM records:

>d1xara_ d.169.1.1 (A:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
yqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktae
eqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcae
fsgsgwndnrcdvdnywickkpaacf

Timeline for d1xara_:

• d1xara_ first appeared in SCOP 1.71
  
• d1xara_ appears in SCOPe 2.07