Lineage for d1xapa_ (1xap A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729417Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species)
  7. 2729418Species Human (Homo sapiens) [TaxId:9606] [117013] (3 PDB entries)
    Uniprot P10826 182-416
  8. 2729421Domain d1xapa_: 1xap A: [115038]
    complexed with ttb

Details for d1xapa_

PDB Entry: 1xap (more details), 2.1 Å

PDB Description: structure of the ligand binding domain of the retinoic acid receptor beta
PDB Compounds: (A:) Retinoic acid receptor beta

SCOPe Domain Sequences for d1xapa_:

Sequence, based on SEQRES records: (download)

>d1xapa_ a.123.1.1 (A:) Retinoic acid receptor beta (RAR-beta) {Human (Homo sapiens) [TaxId: 9606]}
aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlen

Sequence, based on observed residues (ATOM records): (download)

>d1xapa_ a.123.1.1 (A:) Retinoic acid receptor beta (RAR-beta) {Human (Homo sapiens) [TaxId: 9606]}
aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
yirkrrphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlen

SCOPe Domain Coordinates for d1xapa_:

Click to download the PDB-style file with coordinates for d1xapa_.
(The format of our PDB-style files is described here.)

Timeline for d1xapa_: