Lineage for d1xaka_ (1xak A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 789757Superfamily b.1.24: Accessory protein X4 (ORF8, ORF7a) [117066] (1 family) (S)
  5. 789758Family b.1.24.1: Accessory protein X4 (ORF8, ORF7a) [117067] (1 protein)
  6. 789759Protein Accessory protein X4 (ORF8, ORF7a) [117068] (1 species)
  7. 789760Species SARS coronavirus [TaxId:227859] [117069] (1 PDB entry)
    Uniprot P59635 15-82
  8. 789761Domain d1xaka_: 1xak A: [115037]

Details for d1xaka_

PDB Entry: 1xak (more details), 1.8 Å

PDB Description: structure of the sars-coronavirus orf7a accessory protein
PDB Compounds: (A:) sars orf7a accessory protein

SCOP Domain Sequences for d1xaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xaka_ b.1.24.1 (A:) Accessory protein X4 (ORF8, ORF7a) {SARS coronavirus [TaxId: 227859]}
celyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrht
yqlrarsv

SCOP Domain Coordinates for d1xaka_:

Click to download the PDB-style file with coordinates for d1xaka_.
(The format of our PDB-style files is described here.)

Timeline for d1xaka_: