SCOPe 2.05: Domain d1xa8d_: 1xa8 D:

Lineage for d1xa8d_ (1xa8 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein)
   Pfam PF04828; DUF636

6. Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species)

7. Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries)
   Uniprot Q51669

8. Domain d1xa8d_: 1xa8 D: [115036]
   complexed with gol, gsh, so4, zn

Details for d1xa8d_

PDB Entry: 1xa8, 2.4 Å

PDB Description: crystal structure analysis of glutathione-dependent formaldehyde- activating enzyme (gfa)

PDB Compounds: (D:) Glutathione-dependent formaldehyde-activating enzyme

SCOPe Domain Sequences for d1xa8d_:

Sequence; same for both SEQRES and ATOM records:

>d1xa8d_ b.88.1.4 (D:) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]}
mvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkp
egaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygl
dfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmda
iathiakrsgalaa

Timeline for d1xa8d_:

• d1xa8d_ first appeared in SCOP 1.71
  
• d1xa8d_ appears in SCOPe 2.04
  
• d1xa8d_ is called d1xa8d1 in SCOPe 2.06
  
• d1xa8d_ appears in the current release, SCOPe 2.08, called d1xa8d1