Lineage for d1xa8d_ (1xa8 D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568472Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 568473Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 568495Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein)
    Pfam 04828; DUF636
  6. 568496Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species)
  7. 568497Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries)
  8. 568501Domain d1xa8d_: 1xa8 D: [115036]
    complexed with gol, gtt, so4, zn

Details for d1xa8d_

PDB Entry: 1xa8 (more details), 2.4 Å

PDB Description: crystal structure analysis of glutathione-dependent formaldehyde- activating enzyme (gfa)

SCOP Domain Sequences for d1xa8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa8d_ b.88.1.4 (D:) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans}
mvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkp
egaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygl
dfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmda
iathiakrsgalaa

SCOP Domain Coordinates for d1xa8d_:

Click to download the PDB-style file with coordinates for d1xa8d_.
(The format of our PDB-style files is described here.)

Timeline for d1xa8d_: