SCOP 1.73: Domain d1xa8b_: 1xa8 B:

Lineage for d1xa8b_ (1xa8 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.88: Mss4-like [51315] (1 superfamily)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (4 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein)
   Pfam PF04828; DUF636

6. Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species)

7. Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries)

8. Domain d1xa8b_: 1xa8 B: [115034]

Details for d1xa8b_

PDB Entry: 1xa8, 2.4 Å

PDB Description: crystal structure analysis of glutathione-dependent formaldehyde- activating enzyme (gfa)

PDB Compounds: (B:) Glutathione-dependent formaldehyde-activating enzyme

SCOP Domain Sequences for d1xa8b_:

Sequence; same for both SEQRES and ATOM records:

>d1xa8b_ b.88.1.4 (B:) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]}
ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
daiathiakrsgalaa

Timeline for d1xa8b_:

• d1xa8b_ first appeared in SCOP 1.71
  
• d1xa8b_ appears in SCOP 1.75
  
• d1xa8b_ appears in the current release, SCOPe 2.08, called d1xa8b1