Lineage for d1xa8a_ (1xa8 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678786Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 678787Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 678818Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein)
    Pfam PF04828; DUF636
  6. 678819Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species)
  7. 678820Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries)
  8. 678825Domain d1xa8a_: 1xa8 A: [115033]

Details for d1xa8a_

PDB Entry: 1xa8 (more details), 2.4 Å

PDB Description: crystal structure analysis of glutathione-dependent formaldehyde- activating enzyme (gfa)
PDB Compounds: (A:) Glutathione-dependent formaldehyde-activating enzyme

SCOP Domain Sequences for d1xa8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa8a_ b.88.1.4 (A:) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]}
ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
daiathiakrsgalaa

SCOP Domain Coordinates for d1xa8a_:

Click to download the PDB-style file with coordinates for d1xa8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xa8a_: