![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (5 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein) Pfam PF04828; DUF636 |
![]() | Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries) Uniprot Q51669 |
![]() | Domain d1xa8a1: 1xa8 A:4-196 [115033] Other proteins in same PDB: d1xa8a2, d1xa8b2, d1xa8c2, d1xa8d2 complexed with gol, gsh, so4, zn |
PDB Entry: 1xa8 (more details), 2.4 Å
SCOPe Domain Sequences for d1xa8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xa8a1 b.88.1.4 (A:4-196) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]} vdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkpe gaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygld fvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmdai athiakrsgalaa
Timeline for d1xa8a1: