Lineage for d1xa6a3 (1xa6 A:209-270)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642488Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642489Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2642490Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2642491Protein Beta-chimaerin, middle domain [118307] (1 species)
  7. 2642492Species Human (Homo sapiens) [TaxId:9606] [118308] (1 PDB entry)
    Uniprot P52757 23-468
  8. 2642493Domain d1xa6a3: 1xa6 A:209-270 [115032]
    Other proteins in same PDB: d1xa6a1, d1xa6a2
    complexed with zn

Details for d1xa6a3

PDB Entry: 1xa6 (more details), 3.2 Å

PDB Description: Crystal Structure of the Human Beta2-Chimaerin
PDB Compounds: (A:) Beta2-chimaerin

SCOPe Domain Sequences for d1xa6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]}
yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkr
ik

SCOPe Domain Coordinates for d1xa6a3:

Click to download the PDB-style file with coordinates for d1xa6a3.
(The format of our PDB-style files is described here.)

Timeline for d1xa6a3: