Class g: Small proteins [56992] (98 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
Protein Beta-chimaerin, middle domain [118307] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118308] (1 PDB entry) Uniprot P52757 23-468 |
Domain d1xa6a3: 1xa6 A:209-270 [115032] Other proteins in same PDB: d1xa6a1, d1xa6a2 complexed with zn |
PDB Entry: 1xa6 (more details), 3.2 Å
SCOPe Domain Sequences for d1xa6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkr ik
Timeline for d1xa6a3: