SCOPe 2.06: Domain d1xa6a3: 1xa6 A:209-270

Lineage for d1xa6a3 (1xa6 A:209-270)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
   Pfam PF00130

6. Protein Beta-chimaerin, middle domain [118307] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118308] (1 PDB entry)
   Uniprot P52757 23-468

8. Domain d1xa6a3: 1xa6 A:209-270 [115032]
   Other proteins in same PDB: d1xa6a1, d1xa6a2
   complexed with zn

Details for d1xa6a3

PDB Entry: 1xa6, 3.2 Å

PDB Description: Crystal Structure of the Human Beta2-Chimaerin

PDB Compounds: (A:) Beta2-chimaerin

SCOPe Domain Sequences for d1xa6a3:

Sequence; same for both SEQRES and ATOM records:

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]}
yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkr
ik

Timeline for d1xa6a3:

• d1xa6a3 first appeared in SCOP 1.71
  
• d1xa6a3 appears in SCOPe 2.05
  
• d1xa6a3 appears in SCOPe 2.07
  
• d1xa6a3 appears in the current release, SCOPe 2.08