SCOP 1.71: Domain d1xa6a2: 1xa6 A:21-161

Lineage for d1xa6a2 (1xa6 A:21-161)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (31 proteins)
   Pfam 00017

6. Protein Beta-chimaerin, N-terminal domain [118052] (1 species)
   includes N-terminal tail and the linker to the next domain

7. Species Human (Homo sapiens) [TaxId:9606] [118053] (1 PDB entry)

8. Domain d1xa6a2: 1xa6 A:21-161 [115031]
   Other proteins in same PDB: d1xa6a1, d1xa6a3
   complexed with zn

Details for d1xa6a2

PDB Entry: 1xa6, 3.2 Å

PDB Description: Crystal Structure of the Human Beta2-Chimaerin

SCOP Domain Sequences for d1xa6a2:

Sequence; same for both SEQRES and ATOM records:

>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens)}
ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayil
resqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaae
yiskmttnpiyehigyatllr

Timeline for d1xa6a2:

• d1xa6a2 is new in SCOP 1.71
  
• d1xa6a2 appears in SCOP 1.73
  
• d1xa6a2 appears in the current release, SCOPe 2.07