Lineage for d1xa6a2 (1xa6 A:21-161)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608035Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 608036Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 608037Family d.93.1.1: SH2 domain [55551] (31 proteins)
    Pfam 00017
  6. 608051Protein Beta-chimaerin, N-terminal domain [118052] (1 species)
    includes N-terminal tail and the linker to the next domain
  7. 608052Species Human (Homo sapiens) [TaxId:9606] [118053] (1 PDB entry)
  8. 608053Domain d1xa6a2: 1xa6 A:21-161 [115031]
    Other proteins in same PDB: d1xa6a1, d1xa6a3
    complexed with zn

Details for d1xa6a2

PDB Entry: 1xa6 (more details), 3.2 Å

PDB Description: Crystal Structure of the Human Beta2-Chimaerin

SCOP Domain Sequences for d1xa6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens)}
ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayil
resqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaae
yiskmttnpiyehigyatllr

SCOP Domain Coordinates for d1xa6a2:

Click to download the PDB-style file with coordinates for d1xa6a2.
(The format of our PDB-style files is described here.)

Timeline for d1xa6a2: