Lineage for d1xa3b_ (1xa3 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595276Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 595277Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (1 family) (S)
  5. 595278Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (3 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 595279Protein Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB [117754] (1 species)
  7. 595280Species Escherichia coli [TaxId:562] [117755] (2 PDB entries)
  8. 595282Domain d1xa3b_: 1xa3 B: [115026]
    complexed with btb, so4

Details for d1xa3b_

PDB Entry: 1xa3 (more details), 1.85 Å

PDB Description: Crystal structure of CaiB, a type III CoA transferase in carnitine metabolism

SCOP Domain Sequences for d1xa3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa3b_ c.123.1.1 (B:) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli}
lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
pgqiwrgmpshgmdtaailknigysendiqelvskglakv

SCOP Domain Coordinates for d1xa3b_:

Click to download the PDB-style file with coordinates for d1xa3b_.
(The format of our PDB-style files is described here.)

Timeline for d1xa3b_: