SCOPe 2.07: Domain d1xa0b2: 1xa0 B:119-294

Lineage for d1xa0b2 (1xa0 B:119-294)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein B. subtilis YhfP homologue [117403] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117404] (1 PDB entry)
   Uniprot Q5L022; 96% sequence identity; Geobacillus kaustophilus TaxID:1462

8. Domain d1xa0b2: 1xa0 B:119-294 [115024]
   Other proteins in same PDB: d1xa0a1, d1xa0b1
   Structural genomics target
   complexed with cl, so4

Details for d1xa0b2

PDB Entry: 1xa0, 2.8 Å

PDB Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus

PDB Compounds: (B:) Putative NADPH Dependent oxidoreductases

SCOPe Domain Sequences for d1xa0b2:

Sequence, based on SEQRES records:

>d1xa0b2 c.2.1.1 (B:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
ltlkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytve
astgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmry
ggavavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpd

Sequence, based on observed residues (ATOM records):

>d1xa0b2 c.2.1.1 (B:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
ltlkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytve
astgkaaehdylrvlgakevlaerirpldkqrwaaavdpvggrtlatvlsrmryggavav
sgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpd

Timeline for d1xa0b2:

• d1xa0b2 first appeared in SCOP 1.71
  
• d1xa0b2 appears in SCOPe 2.06
  
• d1xa0b2 appears in the current release, SCOPe 2.08