Lineage for d1xa0b2 (1xa0 B:119-294)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574340Protein B. subtilis YhfP homologue [117403] (1 species)
  7. 574341Species Bacillus stearothermophilus [TaxId:1422] [117404] (1 PDB entry)
  8. 574343Domain d1xa0b2: 1xa0 B:119-294 [115024]
    Other proteins in same PDB: d1xa0a1, d1xa0b1
    Structural genomics target
    complexed with cl, so4

Details for d1xa0b2

PDB Entry: 1xa0 (more details), 2.8 Å

PDB Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus

SCOP Domain Sequences for d1xa0b2:

Sequence, based on SEQRES records: (download)

>d1xa0b2 c.2.1.1 (B:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus}
ltlkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytve
astgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmry
ggavavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpd

Sequence, based on observed residues (ATOM records): (download)

>d1xa0b2 c.2.1.1 (B:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus}
ltlkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytve
astgkaaehdylrvlgakevlaerirpldkqrwaaavdpvggrtlatvlsrmryggavav
sgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpd

SCOP Domain Coordinates for d1xa0b2:

Click to download the PDB-style file with coordinates for d1xa0b2.
(The format of our PDB-style files is described here.)

Timeline for d1xa0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xa0b1