SCOP 1.73: Domain d1xa0b1: 1xa0 B:2-118,B:295-327

Lineage for d1xa0b1 (1xa0 B:2-118,B:295-327)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein B. subtilis YhfP homologue [117169] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117170] (1 PDB entry)

8. Domain d1xa0b1: 1xa0 B:2-118,B:295-327 [115023]
   Other proteins in same PDB: d1xa0a2, d1xa0b2
   Structural genomics target
   complexed with cl, so4

Details for d1xa0b1

PDB Entry: 1xa0, 2.8 Å

PDB Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus

PDB Compounds: (B:) Putative NADPH Dependent oxidoreductases

SCOP Domain Sequences for d1xa0b1:

Sequence, based on SEQRES records:

>d1xa0b1 b.35.1.2 (B:2-118,B:295-327) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
safqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktyp
fvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkgXle
riaqeislaelpqalkrilrgelrgrtvvrl

Sequence, based on observed residues (ATOM records):

>d1xa0b1 b.35.1.2 (B:2-118,B:295-327) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}
safqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktyp
fvpgidlagvvvssqhpegdeviatgyeigvthfggyseyarlhgewlvplpkgXleria
qeislaelpqalkrilrgelrgrtvvrl

Timeline for d1xa0b1:

• d1xa0b1 first appeared in SCOP 1.71
  
• d1xa0b1 appears in SCOP 1.75
  
• d1xa0b1 appears in the current release, SCOPe 2.08