![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
![]() | Protein B. subtilis YhfP homologue [117403] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [117404] (1 PDB entry) |
![]() | Domain d1xa0a2: 1xa0 A:119-294 [115022] Other proteins in same PDB: d1xa0a1, d1xa0b1 |
PDB Entry: 1xa0 (more details), 2.8 Å
SCOP Domain Sequences for d1xa0a2:
Sequence, based on SEQRES records: (download)
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus} ltlkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytve astgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmry ggavavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpd
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus} ltlkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytve astgkaaehdylrvlgakevlareldkqrwaaavdpvggrtlatvlsrmryggavavsgl tggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpd
Timeline for d1xa0a2: