Lineage for d1xa0a1 (1xa0 A:1-118,A:295-328)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558334Protein B. subtilis YhfP homologue [117169] (1 species)
  7. 558335Species Bacillus stearothermophilus [TaxId:1422] [117170] (1 PDB entry)
  8. 558336Domain d1xa0a1: 1xa0 A:1-118,A:295-328 [115021]
    Other proteins in same PDB: d1xa0a2, d1xa0b2

Details for d1xa0a1

PDB Entry: 1xa0 (more details), 2.8 Å

PDB Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus

SCOP Domain Sequences for d1xa0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus}
msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkgXl
eriaqeislaelpqalkrilrgelrgrtvvrla

SCOP Domain Coordinates for d1xa0a1:

Click to download the PDB-style file with coordinates for d1xa0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xa0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xa0a2