Lineage for d1x9zb_ (1x9z B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009956Fold d.292: DNA mismatch repair protein MutL [118115] (1 superfamily)
    consists of two different alpha+beta (sub)domains; d1: [beta(3)-alpha-(insert of d2)-alpha(2)-beta; 2 layers, a/b; antiparallel sheet, order: 1234]; d2: [beta-alpha-beta(2)-alpha(2); 2 layers, a/b; antiparallel sheet, order: 132]
  4. 3009957Superfamily d.292.1: DNA mismatch repair protein MutL [118116] (1 family) (S)
  5. 3009958Family d.292.1.1: DNA mismatch repair protein MutL [118117] (1 protein)
  6. 3009959Protein DNA mismatch repair protein MutL [118118] (1 species)
  7. 3009960Species Escherichia coli [TaxId:562] [118119] (1 PDB entry)
    Uniprot P23367 433-614 # structure of the N-terminal domains (1-349) is also known, (55883) and 54226
  8. 3009962Domain d1x9zb_: 1x9z B: [115020]
    complexed with cl, gol, ipa, na

Details for d1x9zb_

PDB Entry: 1x9z (more details), 2.1 Å

PDB Description: Crystal structure of the MutL C-terminal domain
PDB Compounds: (B:) DNA mismatch repair protein mutL

SCOPe Domain Sequences for d1x9zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9zb_ d.292.1.1 (B:) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
sqsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqplliplrlk
vsaeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligylakqsv
fepgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhpaika
lk

SCOPe Domain Coordinates for d1x9zb_:

Click to download the PDB-style file with coordinates for d1x9zb_.
(The format of our PDB-style files is described here.)

Timeline for d1x9zb_: