![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.292: DNA mismatch repair protein MutL [118115] (1 superfamily) consists of two different alpha+beta (sub)domains; d1: [beta(3)-alpha-(insert of d2)-alpha(2)-beta; 2 layers, a/b; antiparallel sheet, order: 1234]; d2: [beta-alpha-beta(2)-alpha(2); 2 layers, a/b; antiparallel sheet, order: 132] |
![]() | Superfamily d.292.1: DNA mismatch repair protein MutL [118116] (1 family) ![]() |
![]() | Family d.292.1.1: DNA mismatch repair protein MutL [118117] (1 protein) |
![]() | Protein DNA mismatch repair protein MutL [118118] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [118119] (1 PDB entry) Uniprot P23367 433-614 # structure of the N-terminal domains (1-349) is also known, (55883) and 54226 |
![]() | Domain d1x9zb_: 1x9z B: [115020] complexed with cl, gol, ipa, na |
PDB Entry: 1x9z (more details), 2.1 Å
SCOPe Domain Sequences for d1x9zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9zb_ d.292.1.1 (B:) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} sqsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqplliplrlk vsaeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligylakqsv fepgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhpaika lk
Timeline for d1x9zb_: