Lineage for d1x9za_ (1x9z A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617311Fold d.292: DNA mismatch repair protein MutL [118115] (1 superfamily)
    consists of two different alpha+beta (sub)domains; d1: [beta(3)-alpha-(insert of d2)-alpha(2)-beta; 2 layers, a/b; antiparallel sheet, order: 1234]; d2: [beta-alpha-beta(2)-alpha(2); 2 layers, a/b; antiparallel sheet, order: 132]
  4. 617312Superfamily d.292.1: DNA mismatch repair protein MutL [118116] (1 family) (S)
  5. 617313Family d.292.1.1: DNA mismatch repair protein MutL [118117] (1 protein)
  6. 617314Protein DNA mismatch repair protein MutL [118118] (1 species)
  7. 617315Species Escherichia coli [TaxId:562] [118119] (1 PDB entry)
  8. 617316Domain d1x9za_: 1x9z A: [115019]

Details for d1x9za_

PDB Entry: 1x9z (more details), 2.1 Å

PDB Description: Crystal structure of the MutL C-terminal domain

SCOP Domain Sequences for d1x9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9za_ d.292.1.1 (A:) DNA mismatch repair protein MutL {Escherichia coli}
qsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqplliplrlkv
saeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligylakqsvf
epgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhpaikal
kd

SCOP Domain Coordinates for d1x9za_:

Click to download the PDB-style file with coordinates for d1x9za_.
(The format of our PDB-style files is described here.)

Timeline for d1x9za_: