SCOPe 2.08: Domain d1x9za_: 1x9z A:

Lineage for d1x9za_ (1x9z A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.292: DNA mismatch repair protein MutL [118115] (1 superfamily)
   consists of two different alpha+beta (sub)domains; d1: [beta(3)-alpha-(insert of d2)-alpha(2)-beta; 2 layers, a/b; antiparallel sheet, order: 1234]; d2: [beta-alpha-beta(2)-alpha(2); 2 layers, a/b; antiparallel sheet, order: 132]

4. Superfamily d.292.1: DNA mismatch repair protein MutL [118116] (1 family)

5. Family d.292.1.1: DNA mismatch repair protein MutL [118117] (1 protein)

6. Protein DNA mismatch repair protein MutL [118118] (1 species)

7. Species Escherichia coli [TaxId:562] [118119] (1 PDB entry)
   Uniprot P23367 433-614 # structure of the N-terminal domains (1-349) is also known, (55883) and 54226

8. Domain d1x9za_: 1x9z A: [115019]
   complexed with cl, gol, ipa, na

Details for d1x9za_

PDB Entry: 1x9z, 2.1 Å

PDB Description: Crystal structure of the MutL C-terminal domain

PDB Compounds: (A:) DNA mismatch repair protein mutL

SCOPe Domain Sequences for d1x9za_:

Sequence; same for both SEQRES and ATOM records:

>d1x9za_ d.292.1.1 (A:) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
qsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqplliplrlkv
saeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligylakqsvf
epgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhpaikal
kd

Timeline for d1x9za_:

• d1x9za_ first appeared in SCOP 1.71
  
• d1x9za_ appears in SCOPe 2.07