SCOP 1.71: Domain d1x9yd1: 1x9y D:223-393

Lineage for d1x9yd1 (1x9y D:223-393)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (12 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein Staphopain SspB [102721] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102722] (2 PDB entries)

8. Domain d1x9yd1: 1x9y D:223-393 [115017]
   Other proteins in same PDB: d1x9ya2, d1x9yb2, d1x9yc2, d1x9yd2

Details for d1x9yd1

PDB Entry: 1x9y, 2.5 Å

PDB Description: The prostaphopain B structure

SCOP Domain Sequences for d1x9yd1:

Sequence; same for both SEQRES and ATOM records:

>d1x9yd1 d.3.1.1 (D:223-393) Staphopain SspB {Staphylococcus aureus}
qyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpnc
atfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghal
avvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy

Timeline for d1x9yd1:

• d1x9yd1 is new in SCOP 1.71
  
• d1x9yd1 appears in SCOP 1.73
  
• d1x9yd1 appears in the current release, SCOPe 2.08