| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (4 families) ![]() has a additional strand at the N-terminus |
| Family d.17.1.4: Staphopain B, prodomain [117846] (1 protein) |
| Protein Staphopain B, prodomain [117847] (1 species) includes additional beta-sheet subdomain, connecting the N-terminal cystatin-like domain to the catalytic domain/mature enzyme |
| Species Staphylococcus aureus [TaxId:1280] [117848] (1 PDB entry) |
| Domain d1x9yc2: 1x9y C:41-211 [115016] Other proteins in same PDB: d1x9ya1, d1x9yb1, d1x9yc1, d1x9yd1 |
PDB Entry: 1x9y (more details), 2.5 Å
SCOP Domain Sequences for d1x9yc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9yc2 d.17.1.4 (C:41-211) Staphopain B, prodomain {Staphylococcus aureus}
kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkv
Timeline for d1x9yc2: