Lineage for d1x9yb2 (1x9y B:41-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935848Family d.17.1.4: Staphopain B, prodomain [117846] (1 protein)
  6. 2935849Protein Staphopain B, prodomain [117847] (1 species)
    includes additional beta-sheet subdomain, connecting the N-terminal cystatin-like domain to the catalytic domain/mature enzyme
  7. 2935850Species Staphylococcus aureus [TaxId:1280] [117848] (1 PDB entry)
    Uniprot Q70UQ9 41-393
  8. 2935852Domain d1x9yb2: 1x9y B:41-211 [115014]
    Other proteins in same PDB: d1x9ya1, d1x9ya3, d1x9yb1, d1x9yb3, d1x9yc1, d1x9yc3, d1x9yd1, d1x9yd3

Details for d1x9yb2

PDB Entry: 1x9y (more details), 2.5 Å

PDB Description: The prostaphopain B structure
PDB Compounds: (B:) cysteine proteinase

SCOPe Domain Sequences for d1x9yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9yb2 d.17.1.4 (B:41-211) Staphopain B, prodomain {Staphylococcus aureus [TaxId: 1280]}
kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkv

SCOPe Domain Coordinates for d1x9yb2:

Click to download the PDB-style file with coordinates for d1x9yb2.
(The format of our PDB-style files is described here.)

Timeline for d1x9yb2: