SCOP 1.71: Domain d1x9ya2: 1x9y A:41-211

Lineage for d1x9ya2 (1x9y A:41-211)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (4 families)
   has a additional strand at the N-terminus

5. Family d.17.1.4: Staphopain B, prodomain [117846] (1 protein)

6. Protein Staphopain B, prodomain [117847] (1 species)
   includes additional beta-sheet subdomain, connecting the N-terminal cystatin-like domain to the catalytic domain/mature enzyme

7. Species Staphylococcus aureus [TaxId:1280] [117848] (1 PDB entry)

8. Domain d1x9ya2: 1x9y A:41-211 [115012]
   Other proteins in same PDB: d1x9ya1, d1x9yb1, d1x9yc1, d1x9yd1

Details for d1x9ya2

PDB Entry: 1x9y, 2.5 Å

PDB Description: The prostaphopain B structure

SCOP Domain Sequences for d1x9ya2:

Sequence; same for both SEQRES and ATOM records:

>d1x9ya2 d.17.1.4 (A:41-211) Staphopain B, prodomain {Staphylococcus aureus}
kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkv

Timeline for d1x9ya2:

• d1x9ya2 is new in SCOP 1.71
  
• d1x9ya2 appears in SCOP 1.73
  
• d1x9ya2 appears in the current release, SCOPe 2.08