Lineage for d1x9ya2 (1x9y A:41-211)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599697Superfamily d.17.1: Cystatin/monellin [54403] (4 families) (S)
    has a additional strand at the N-terminus
  5. 599773Family d.17.1.4: Staphopain B, prodomain [117846] (1 protein)
  6. 599774Protein Staphopain B, prodomain [117847] (1 species)
    includes additional beta-sheet subdomain, connecting the N-terminal cystatin-like domain to the catalytic domain/mature enzyme
  7. 599775Species Staphylococcus aureus [TaxId:1280] [117848] (1 PDB entry)
  8. 599776Domain d1x9ya2: 1x9y A:41-211 [115012]
    Other proteins in same PDB: d1x9ya1, d1x9yb1, d1x9yc1, d1x9yd1

Details for d1x9ya2

PDB Entry: 1x9y (more details), 2.5 Å

PDB Description: The prostaphopain B structure

SCOP Domain Sequences for d1x9ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ya2 d.17.1.4 (A:41-211) Staphopain B, prodomain {Staphylococcus aureus}
kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkv

SCOP Domain Coordinates for d1x9ya2:

Click to download the PDB-style file with coordinates for d1x9ya2.
(The format of our PDB-style files is described here.)

Timeline for d1x9ya2: