| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (12 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.1: Papain-like [54002] (23 proteins) |
| Protein Staphopain SspB [102721] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [102722] (2 PDB entries) |
| Domain d1x9ya1: 1x9y A:223-393 [115011] Other proteins in same PDB: d1x9ya2, d1x9yb2, d1x9yc2, d1x9yd2 |
PDB Entry: 1x9y (more details), 2.5 Å
SCOP Domain Sequences for d1x9ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9ya1 d.3.1.1 (A:223-393) Staphopain SspB {Staphylococcus aureus}
qyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpnc
atfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghal
avvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy
Timeline for d1x9ya1: