Lineage for d1x9ya1 (1x9y A:223-393)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926930Protein Staphopain SspB [102721] (1 species)
  7. 2926931Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
    Uniprot Q70UQ9 41-393
  8. 2926936Domain d1x9ya1: 1x9y A:223-393 [115011]
    Other proteins in same PDB: d1x9ya2, d1x9ya3, d1x9yb2, d1x9yb3, d1x9yc2, d1x9yc3, d1x9yd2, d1x9yd3
    missing some secondary structures that made up less than one-third of the common domain

Details for d1x9ya1

PDB Entry: 1x9y (more details), 2.5 Å

PDB Description: The prostaphopain B structure
PDB Compounds: (A:) cysteine proteinase

SCOPe Domain Sequences for d1x9ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ya1 d.3.1.1 (A:223-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
qyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpnc
atfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghal
avvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy

SCOPe Domain Coordinates for d1x9ya1:

Click to download the PDB-style file with coordinates for d1x9ya1.
(The format of our PDB-style files is described here.)

Timeline for d1x9ya1: