Lineage for d1x9na3 (1x9n A:534-753)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585823Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2585824Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
    automatically mapped to Pfam PF01068
  6. 2585836Protein DNA ligase I (LIG1) [118122] (1 species)
  7. 2585837Species Human (Homo sapiens) [TaxId:9606] [118123] (1 PDB entry)
    Uniprot P18858 262-901
  8. 2585838Domain d1x9na3: 1x9n A:534-753 [115004]
    Other proteins in same PDB: d1x9na1, d1x9na2
    protein/DNA complex; complexed with amp

Details for d1x9na3

PDB Entry: 1x9n (more details), 3 Å

PDB Description: Crystal Structure of Human DNA Ligase I bound to 5'-adenylated, nicked DNA
PDB Compounds: (A:) DNA ligase I

SCOPe Domain Sequences for d1x9na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9na3 d.142.2.1 (A:534-753) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]}
lspgiplkpmlahptrgisevlkrfeeaaftceykydgqraqihaleggevkifsrnqed
ntgkypdiisripkiklpsvtsfildteavawdrekkqiqpfqvlttrkrkevdaseiqv
qvclyafdliylngeslvreplsrrrqllrenfvetegefvfatsldtkdieqiaefleq
svkdsceglmvktldvdatyeiakrshnwlklkkdyldgv

SCOPe Domain Coordinates for d1x9na3:

Click to download the PDB-style file with coordinates for d1x9na3.
(The format of our PDB-style files is described here.)

Timeline for d1x9na3: