![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins) automatically mapped to Pfam PF01068 |
![]() | Protein DNA ligase I (LIG1) [118122] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118123] (1 PDB entry) Uniprot P18858 262-901 |
![]() | Domain d1x9na3: 1x9n A:534-753 [115004] Other proteins in same PDB: d1x9na1, d1x9na2 protein/DNA complex; complexed with amp |
PDB Entry: 1x9n (more details), 3 Å
SCOPe Domain Sequences for d1x9na3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9na3 d.142.2.1 (A:534-753) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]} lspgiplkpmlahptrgisevlkrfeeaaftceykydgqraqihaleggevkifsrnqed ntgkypdiisripkiklpsvtsfildteavawdrekkqiqpfqvlttrkrkevdaseiqv qvclyafdliylngeslvreplsrrrqllrenfvetegefvfatsldtkdieqiaefleq svkdsceglmvktldvdatyeiakrshnwlklkkdyldgv
Timeline for d1x9na3: