Lineage for d1x9na2 (1x9n A:754-901)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790201Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 2790213Protein DNA ligase I (LIG1) [117202] (1 species)
  7. 2790214Species Human (Homo sapiens) [TaxId:9606] [117203] (1 PDB entry)
    Uniprot P18858 262-901
  8. 2790215Domain d1x9na2: 1x9n A:754-901 [115003]
    Other proteins in same PDB: d1x9na1, d1x9na3
    protein/DNA complex; complexed with amp
    has additional insertions and/or extensions that are not grouped together

Details for d1x9na2

PDB Entry: 1x9n (more details), 3 Å

PDB Description: Crystal Structure of Human DNA Ligase I bound to 5'-adenylated, nicked DNA
PDB Compounds: (A:) DNA ligase I

SCOPe Domain Sequences for d1x9na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9na2 b.40.4.6 (A:754-901) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]}
gdtldlvvigaylgrgkragryggfllasydedseelqaicklgtgfsdeeleehhqslk
alvlpsprpyvridgavipdhwldpsavwevkcadlslspiypaarglvdsdkgislrfp
rfirvredkqpeqattsaqvaclyrkqs

SCOPe Domain Coordinates for d1x9na2:

Click to download the PDB-style file with coordinates for d1x9na2.
(The format of our PDB-style files is described here.)

Timeline for d1x9na2: