![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
![]() | Protein DNA ligase I (LIG1) [117202] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117203] (1 PDB entry) Uniprot P18858 262-901 |
![]() | Domain d1x9na2: 1x9n A:754-901 [115003] Other proteins in same PDB: d1x9na1, d1x9na3 protein/DNA complex; complexed with amp has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1x9n (more details), 3 Å
SCOPe Domain Sequences for d1x9na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9na2 b.40.4.6 (A:754-901) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]} gdtldlvvigaylgrgkragryggfllasydedseelqaicklgtgfsdeeleehhqslk alvlpsprpyvridgavipdhwldpsavwevkcadlslspiypaarglvdsdkgislrfp rfirvredkqpeqattsaqvaclyrkqs
Timeline for d1x9na2: