Lineage for d1x9na1 (1x9n A:262-533)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546378Fold a.235: ATP-dependent DNA ligase DNA-binding domain [117017] (1 superfamily)
    multihelical; duplication: contains two intertwined structural repeats related by pseudo twofold symmetry
  4. 546379Superfamily a.235.1: ATP-dependent DNA ligase DNA-binding domain [117018] (1 family) (S)
  5. 546380Family a.235.1.1: ATP-dependent DNA ligase DNA-binding domain [117019] (1 protein)
    Pfam 04675
  6. 546381Protein DNA ligase I (LIG1) [117020] (1 species)
  7. 546382Species Human (Homo sapiens) [TaxId:9606] [117021] (1 PDB entry)
  8. 546383Domain d1x9na1: 1x9n A:262-533 [115002]
    Other proteins in same PDB: d1x9na2, d1x9na3
    complexed with amp, doc

Details for d1x9na1

PDB Entry: 1x9n (more details), 3 Å

PDB Description: Crystal Structure of Human DNA Ligase I bound to 5'-adenylated, nicked DNA

SCOP Domain Sequences for d1x9na1:

Sequence, based on SEQRES records: (download)

>d1x9na1 a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human (Homo sapiens)}
dpsgynpaknnyhpvedacwkpgqkvpylavartfekieevsarlrmvetlsnllrsvva
lsppdllpvlylslnhlgppqqglelgvgdgvllkavaqatgrqlesvraeaaekgdvgl
vaensrstqrlmlppppltasgvfskfrdiarltgsastakkidiikglfvacrhsearf
iarslsgrlrlglaeqsvlaalsqavsltppgqefppamvdagkgktaearktwleeqgm
ilkqtfcevpdldriipvllehglerlpehck

Sequence, based on observed residues (ATOM records): (download)

>d1x9na1 a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human (Homo sapiens)}
dpsgynpaknnyhpvedacwkpgqkvpylavartfekieevsarlrmvetlsnllrsvva
lsppdllpvlylslnhlgppqqglelgvgdgvllkavaqatgrqlesvraeaaekgdvgl
vaemlppppltasgvfskfrdiarltgsastakkidiikglfvacrhsearfiarslsgr
lrlglaeqsvlaalsqavsltppgqefppamvdagkgktaearktwleeqgmilkqtfce
vpdldriipvllehglerlpehck

SCOP Domain Coordinates for d1x9na1:

Click to download the PDB-style file with coordinates for d1x9na1.
(The format of our PDB-style files is described here.)

Timeline for d1x9na1: