Lineage for d1x9na1 (1x9n A:262-533)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015790Fold a.235: ATP-dependent DNA ligase DNA-binding domain [117017] (1 superfamily)
    multihelical; duplication: contains two intertwined structural repeats related by pseudo twofold symmetry
  4. 2015791Superfamily a.235.1: ATP-dependent DNA ligase DNA-binding domain [117018] (1 family) (S)
  5. 2015792Family a.235.1.1: ATP-dependent DNA ligase DNA-binding domain [117019] (1 protein)
    Pfam PF04675
  6. 2015793Protein DNA ligase I (LIG1) [117020] (1 species)
  7. 2015794Species Human (Homo sapiens) [TaxId:9606] [117021] (1 PDB entry)
    Uniprot P18858 262-901
  8. 2015795Domain d1x9na1: 1x9n A:262-533 [115002]
    Other proteins in same PDB: d1x9na2, d1x9na3
    protein/DNA complex; complexed with amp

Details for d1x9na1

PDB Entry: 1x9n (more details), 3 Å

PDB Description: Crystal Structure of Human DNA Ligase I bound to 5'-adenylated, nicked DNA
PDB Compounds: (A:) DNA ligase I

SCOPe Domain Sequences for d1x9na1:

Sequence, based on SEQRES records: (download)

>d1x9na1 a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]}
dpsgynpaknnyhpvedacwkpgqkvpylavartfekieevsarlrmvetlsnllrsvva
lsppdllpvlylslnhlgppqqglelgvgdgvllkavaqatgrqlesvraeaaekgdvgl
vaensrstqrlmlppppltasgvfskfrdiarltgsastakkidiikglfvacrhsearf
iarslsgrlrlglaeqsvlaalsqavsltppgqefppamvdagkgktaearktwleeqgm
ilkqtfcevpdldriipvllehglerlpehck

Sequence, based on observed residues (ATOM records): (download)

>d1x9na1 a.235.1.1 (A:262-533) DNA ligase I (LIG1) {Human (Homo sapiens) [TaxId: 9606]}
dpsgynpaknnyhpvedacwkpgqkvpylavartfekieevsarlrmvetlsnllrsvva
lsppdllpvlylslnhlgppqqglelgvgdgvllkavaqatgrqlesvraeaaekgdvgl
vaemlppppltasgvfskfrdiarltgsastakkidiikglfvacrhsearfiarslsgr
lrlglaeqsvlaalsqavsltppgqefppamvdagkgktaearktwleeqgmilkqtfce
vpdldriipvllehglerlpehck

SCOPe Domain Coordinates for d1x9na1:

Click to download the PDB-style file with coordinates for d1x9na1.
(The format of our PDB-style files is described here.)

Timeline for d1x9na1: