Lineage for d1x9ia_ (1x9i A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709184Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 709185Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 709186Family c.80.1.1: double-SIS domain [53698] (4 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 709200Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)
  7. 709201Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
  8. 709204Domain d1x9ia_: 1x9i A: [114997]

Details for d1x9ia_

PDB Entry: 1x9i (more details), 1.16 Å

PDB Description: crystal structure of crystal structure of phosphoglucose/phosphomannose phosphoglucose/phosphomannoseisomerase from pyrobaculum aerophilum in complex with glucose 6-phosphate
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOP Domain Sequences for d1x9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ia_ c.80.1.1 (A:) Glucose-6-phosphate isomerase, conjectural {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl

SCOP Domain Coordinates for d1x9ia_:

Click to download the PDB-style file with coordinates for d1x9ia_.
(The format of our PDB-style files is described here.)

Timeline for d1x9ia_: