Lineage for d1x9ha_ (1x9h A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592149Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 592150Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 592151Family c.80.1.1: double-SIS domain [53698] (4 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 592160Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)
  7. 592161Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
  8. 592168Domain d1x9ha_: 1x9h A: [114995]

Details for d1x9ha_

PDB Entry: 1x9h (more details), 1.5 Å

PDB Description: crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with fructose 6-phosphate

SCOP Domain Sequences for d1x9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ha_ c.80.1.1 (A:) Glucose-6-phosphate isomerase, conjectural {Archaeon Pyrobaculum aerophilum}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
q

SCOP Domain Coordinates for d1x9ha_:

Click to download the PDB-style file with coordinates for d1x9ha_.
(The format of our PDB-style files is described here.)

Timeline for d1x9ha_: