Lineage for d1x9fj_ (1x9f J:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758428Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) [116754] (1 species)
  7. 758429Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116755] (2 PDB entries)
    Uniprot P02218
  8. 758432Domain d1x9fj_: 1x9f J: [114992]
    Other proteins in same PDB: d1x9fa_, d1x9fc_, d1x9fd_, d1x9fe_, d1x9fg_, d1x9fh_, d1x9fi_, d1x9fk_, d1x9fl_
    complexed with cmo, hem, po4

Details for d1x9fj_

PDB Entry: 1x9f (more details), 2.6 Å

PDB Description: hemoglobin dodecamer from lumbricus erythrocruorin
PDB Compounds: (J:) Globin II, extracellular

SCOP Domain Sequences for d1x9fj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9fj_ a.1.1.2 (J:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
lgrcydreawdacidhiedgikghh

SCOP Domain Coordinates for d1x9fj_:

Click to download the PDB-style file with coordinates for d1x9fj_.
(The format of our PDB-style files is described here.)

Timeline for d1x9fj_: