![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) [116752] (1 species) |
![]() | Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116753] (2 PDB entries) |
![]() | Domain d1x9fi_: 1x9f I: [114991] Other proteins in same PDB: d1x9fb_, d1x9fc_, d1x9fd_, d1x9ff_, d1x9fg_, d1x9fh_, d1x9fj_, d1x9fk_, d1x9fl_ complexed with cmo, hem, po4 |
PDB Entry: 1x9f (more details), 2.6 Å
SCOP Domain Sequences for d1x9fi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9fi_ a.1.1.2 (I:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} dccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkidepesg efkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafarvlp qvlscfnvdawnrcfhrlvariakdlp
Timeline for d1x9fi_: